PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc028075.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 131aa    MW: 14680.8 Da    PI: 7.3877
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc028075.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.19.6e-2568116452
                   RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              ++s e++s+yF++p+ +AA eLg+  T+LK +CR+ GI+RWPhRk+ksl
  Itr_sc028075.1_g00003.1  68 TLSREVISSYFHMPVCQAAEELGIEETTLKERCRKVGIPRWPHRKLKSL 116
                              7999*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.06451131IPR003035RWP-RK domain
PfamPF020424.6E-2168116IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MKLLHPPSLI LLTAQFWDTP FGTVICSCQI VVSSDDTSVE SSEVGEVTIV EDNSSKKEGR  60
GRRPVPSTLS REVISSYFHM PVCQAAEELG IEETTLKERC RKVGIPRWPH RKLKSLEALM  120
KNVQVYSFNS S
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FGD11e-19RKD3_ARATH; Protein RKD3
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42742142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.12e-20RWP-RK domain-containing protein